Schluss mit lustig

11. Februar 2021

Von der Spaßgesellschaft zur Angst-Gemeinschaft

Noch vor Jahr und Tag, also vor dem Ausbruch der Coronapandemie, feierte die Spaßgesellschaft – zumindest in den Wohlstandsgesellschaften der westlichen Hemisphäre – richtiggehende Hochämter, der Karneval, der Fasching, zwischen Mainz, Köln und Villach und Rio de Janeiro, bot in Form wahrer Saturnalien ekstatische Unterhaltungen für Millionen. Zu Blasmusik und zu Sambaklängen wurde hier gefeiert und in den Jahrzehnten davor hatte sich längst die sogenannte „Fun Generation“ etabliert, die den Hedonismus zur Zivilreligion erhoben hat. „Party, Party, Party“ lautete die Devise, „Wellness“ die Freizeitbeschäftigung und die diversen Events prägten den Lebensrythmus der Menschen. Das wichtigste war eben Spaß und
„Entertainment“.
Mit dem Ausbreiten der chinesischen Epidemie zu einer weltweiten Pandemie im März des Jahres 2020 ahnte anfangs kaum jemand, dass dies das soziale und gemeinschafts-psychologische Klima in den westlichen Industriestaaten grundlegend ändern würde. Gewiss, der erste Lockdown im Frühjahr 2020 bedeutete unangenehme Einschränkungen und massive Einbrüche für das Wirtschaftswachstum. Nach Ostern aber sollte es, so hieß es , zur Auferstehung kommen und einige Wochen würde man es schon aushalten, so glaubte man. Dass die Lockerungen danach über den Sommer 2020 auch nur halbherzig waren und eine wirkliche Rückkehr zur alten Normalität, insbesondere im Bezug auf die Reisetätigkeit und auf das Gemeinschaftsleben der Menschen, keine wirkliche war, ermöglichte eine Rückkehr zum Status quo ante nicht. Und die zweite Welle, die im Herbst 2020 ausbrach und bereits ab Oktober weltweit lockdownartige Zustände erzwang, machte mit seiner langanhaltenden Dauer klar, dass damit nachhaltige Veränderungen des gesamtgesellschaftlichen Klimas verbunden sein werden: In einem relativ kurzen Zeitraum wurde aus der herkömmlichen Spaßgemeinschaft so etwas wie eine globale Angst-Gemeinschaft.
Begonnen hatte es mit den apokalyptischen Prognosen, wie sie etwa der österreichische Bundeskanzler von sich gab, wo mit Hunderttausend Toten gedroht wurde. Dann ging es weiter mit dem drohenden Zusammenbruch der Gesundheitssysteme. Weiter ging es mit der Horrorvision von Triage, wonach die Ärzte entscheiden müssten, wer auf dem Gang zu sterben habe und wer noch Intensivpflege bekäme. Die Bilder von Massengräbern in den USA und von Hunderten aufgereihten Särgen im italienischen Piemont taten ein Übriges. Und die Regierungen, insbesondere auch jene in Österreich, setzten auf eine Strategie der Angst und des Schreckens, um die Bürger gegenüber den einschränkenden Maßnahmen willfährig zu machen.
Von Seiten der Staatsmacht traten hier sehr rasch obrigkeitsstaatliche, paternalistische, ja autoritäre Verhaltensweisen zu Tage. Da wurde mit Sanktionen gedroht, das Strafmaß für vergleichsweise harmlose Verstöße gegen die Regierungsverordnungen wurde drastisch erhöht und die Menschen wurden im Hinblick auf ihre Grund- und Freiheitsrechte massiv eingeschränkt. Solcherart wurde neben der Seuchenangst der Menschen noch die Angst vor dem Obrigkeitsstaat erzeugt, wonach man bei den harmlosesten Tätigkeiten und Bewegungen im öffentlichen Raum womöglich gegen Ordnung und Gesetz verstoße und gleichzeitig mit Bestrafung zu rechnen hätte. Gleichzeitig wurde allerdings insbesondere in Österreich der zivile Ungehorsam der Bevölkerung und die traditionell ja ohnedies übliche Negierung von Vorschriften gestärkt.
In diesem neuen Klima der Angst traten aber auch höchst unerfeuliche Eigenschaften der Menschen zutage. Das Denunziantentum und so etwas wie ein gewisse Blockwart-Mentalität griffen um sich. Anonyme Anzeigen gegen Coronasünder und die Vernaderung unter Nachbarn wurden in den Zeiten des Lockdowns zur alltäglichen Gewohnheit. Damit fand der neue Obrigkeitsstaat seine Entsprechung in einer neuen Niedertracht eines Teils der Untertanen.
Wenn die vorhergehende Spaßgesellschaft von den politisch korrekten zeitgeistkonformen Schichten der Bevölkerung getragen wurde, so kann man dies nunmehr auch im Hinblick auf die neue Angst-Gemeinschaft sagen. Es gilt gewissermaßen als politisch korrekt, sich als Pandemie-Verängstigter zu erklären und zu deklarieren, wohingegen Kritiker oder Gegner der Regierungsmaßnahmen zur Seuchenbekämpfung sehr schnell als Extremisten oder gar Psychopathen abqualifiziert werden. Damit sind die Apologeten der politischen Korrektheit von einem Extrem, nämlich jenem der Spaßgesellschaft, ins andere Extrem, nämlich jenem der „Angst-Community“, gefallen.
Damit ist der neue Zeitgeist bereit, Geselligkeit und Gemeinschaftsleben widerstandslos preiszugeben. Zusammenkünfte aller Art, Veranstaltungen kultureller oder sportlicher Natur, Familientreffen, ja sogar Stammtische, fallen nun unter den Generalverdacht, „Hot Spots“ der Virusverbreitung zu sein. Auch die touristischen Vergnügungen, die für die „Fun Generation“ selbstverständlich waren, der Badeurlaub auf den Malediven, die Safari in Kenia, das Wochenende in New York, gelten in unserer angstgetriebenen Gesellschaft als gefährliche, ja verantwortungslose Vergnügungen. Die Isola­tion des Einzelnen im Home-Office, der Kinder im Homeschooling und der Alten im Pflegeheim mit Besuchsverbot, wird von dieser angstgetriebenen Gesellschaft als selbstverständlich hingenommen. Und die Angstmache der Obrigkeit samt der ihr angegliederten Wissenschaft, Virologen, Epidemiologie etc. wird als alternativlos akzeptiert. Nachdem indessen ja auch die Durchimpfung der Bevölkerung ganz offensichtlich nicht die Rückkehr zur alten Normalität ermöglichen dürfte, wird all das wohl mehr oder minder zum Dauerzustand werden. Und die neue politische Korrektheit in der Corona-Angst-Gesellschaft scheint kaum Widerstand gegen diese Entwicklung aufzubringen.


Wir Virologen – Der Lockdown als Realsatire

11. Februar 2021

Seit Jahr und Tag sind wir alle nunmehr vertraut mit dem einzigen und wahren Feind der Menschheit, dem Coronavirus. Anfangs im vergangenen Spätwinter, waren es nur die wissenschaftlichen Fachleute, die Virologen, die Epidemiologen, die Experten für öffentliche Gesundheit und die Vertreter ähnlicher Wissenschaftszweige, die Bescheid wußten. Indessen allerdings weiß Hinz und Kunz, wie es um das Virus steht. Wir kennen all seine Mutationen, die südafrikanische Variante, die britische Variante, wir wissen über die Virenlast Bescheid, die uns gefährdet, kennen die Zahl der Antikörper, die man benötigt, um immun zu sein, wir differenzieren ganz professionell zwischen PCR-Tests, Antigen-Tests und Antikörpertests. Und selbstverständlich wissen wir auch Bescheid über die verschiedenen Impfstoffe, auch deren Erzeuger, die Pharmakonzerne Pfizer-BioNTech, AstraZeneca bis hin zu Johnson & Johnson und Moderna, Sputnik und den chinesischen Mao Tse-tung-Impfstoff. Und selbstverständlich wissen wir auch über die verschiedenen Wirkungsweisen dieser Impfungen.
Wir Virologen wissen Bescheid. Und auf allen Fernseh- und Radiostationen, auf allen Stammtischen des Landes, in den Straßenmeistereien genauso wie in der Akademie der Wissenschaften, gibt es nur ein Thema, das Virus. Virologe ist somit zum Beruf, ja zur Berufung für die ganze Bevölkerung geworden.
Und mit Ausnahme der Coronaleugner, jener Ignoranten, Rechtsextremisten, Reichsbürger, Staatsgefährder und Soziopathen, sind wir alle als Experten für das Virus natürlich auch mit gehörigem Respekt, ja mit entsprechender Angst vor demselben erfüllt. Angefangen von den habilitierten Vertretern der hohen Wissenschaft, die uns tagtäglich in den Medien, Fernseh- und Radiostationen, die Alternativlosigkeit des Lockdowns erklären, dass wir Virologen – auch jene mit Hauptschulabschluss – wissen, dass die Inzidenz, die Infektionszahlen, die Anzahl der Hospitalisierungen und jene der belegten Intensivbetten zu hoch ist. Zu hoch um auch nur ansatzweise in das Leben zuvor, vor Corona, zurückzukehren.
Und wir wissen natürlich, dass wir uns spätestens nach dem morgendlichen Aufstehen aus dem eigenen Bett zu maskieren haben, dass wir beim Betreten irgendwelcher Geschäfte einen Umkreis von 20 m2 um die eigene Person freizuhalten haben, dass wir uns mit maximal zwei Erwachsenen aus nur einem zweiten Haushalt privat treffen dürfen, dass wir im Auto gegenüber den Mitfahrenden ebenso Maske zu tragen haben und tunlichst von 20 Uhr bis sechs Uhr zu Hause bleiben müssen.
An Kaffeehäuser, Restaurants und Auslandsreisen, all das Missstände aus vergangenen Zeiten, haben wir uns gefälligst gar nicht mehr zu erinnern und das einstige Gerede vom „grenzen­losen Europa“ haben wir gefälligst auch zu vergessen.
In unsere schönen neuen Welt haben wir nach den Verkündigungen des Innenminister, wonach Coronasünder mit drakonischen Strafen zur rechnen hätten, beifällig zu nicken, dem Gesundheitsminister pflichtschuldigst zuzustimmen, wenn er sagt, dass die nächste Woche die ausschlaggebendste des Jahrhunderts sein werde und dem gottgleichen juvenilen Kanzler, der über all dem steht, abgöttisch zu lieben. Besonders wichtig ist natürlich, voller Abscheu auf alle unbelehrbaren „Covidioten“ zu blicken, die es wagen, auf den Straßen und Plätzen des Landes gegen die weisen Maßnahmen der Regierung zu protestieren.
Wir Virologen wissen natürlich, dass bei einer Wohnbevölkerung von nahezu neun Millionen Menschen zwischen Bodensee und Neusiedler See etwa 14.000 Infizierte, wovon knapp zehn Prozent krank sind und der Spitalsbehandlung bedürfen, und kaum 300 belegten Intensivbetten das rot-weiß-rote Gesundheitssystem zusammenzubrechen droht. Und wir Virologen wissen natürlich auch, dass irgendwelche gefährliche Mutationen des Coronavirus mit Sicherheit auf uns zukommen: die kongolesische Mutation, die tasmanische und die turkmenische. Deswegen müssen wir das Land im Dauerlockdown halten. Was kümmert es uns, dass dieser Lockdown pro Woche etwa 1,7 Milliarden Euro kostet, dass die Arbeitslosenzahlen ungebremst auf etwa zehn Prozent der Wohnbevölkerung hinaufschnellen könnten, dass die Explosion der Staatsschulden bald einen De-facto-Staatsbankrott nach sich ziehen könnten.
Was kümmert uns die psychische Belastung unserer Kinder durch Kontaktverbot mit Gleichaltrigen, was kümmert uns das einsame Sterben unserer Greise in den Pflegeheimen.
Wir Virologen müssen über all das kaltlächelnd hinweggehen. Das gehört zu unserer neuen Normalität.


Vox populi – Volkes Stimme

4. Februar 2021

Die Menschen würden für ihre Freiheit demonstrieren, hieß es in den Medien – und gegen die polizeistaatlichen Maßnahmen einer Regierung, die ihre Rechte nicht respektiere. Tausende sind auf die Straße gegangen und es seien die größten regierungskritischen Maßnahmen seit langem, berichteten die österreichischen Medien mit klar erkennbar positivem Unterton.
Haben sie über die Anti-Corona-Demonstrationen vom vergangenen Sonntag berichtet? Nein, das waren Berichte über die regierungskritischen Demos für den Putin-Kritiker Alexei Nawalny in Russland. Über die Demos in Österreich wurde gleichzeitig in den Mainstream-Medien, angefangen vom Staatsfunk über die sogenannten Qualitätszeitungen bis hin zum Boulevard, fast ausschließlich negativ, aburteilend und kritisch berichtet. Auf den Straßen Wiens wären im Gegensatz zu den Straßen Moskaus Neonazis, Weltverschwörer und Staatsfeinde unterwegs gewesen. Und wenn man in Wien unter dem Motto „Freiheit“ demonstriert habe, sei das doch nur ein neonazistischer Code gewesen, so die Mainstreammedien unisono.
Ähnlich war nur die Optik bei den Demos in Moskau und bei jenen in Wien. Eine schwarzuniformierte, martialisch auftretende Polizei mit schwarzen Vollvisierhelmen und Schlagstöcken eskortierte bzw. bedrängte die Demonstranten. Und unserem Innenminister, an dessen Intelligenzquotienten man zunehmend nach jedem Medienauftritt zu zweifeln beginnt, blieb es vorbehalten zu erklären, dass die Wiener Demonstranten gar die Parlamentsrampe hätten stürmen wollen. Die Parallelen zum Sturm auf das Kapitol in Washington seien unübersehbar gewesen.
Tatsächlich waren es wohl an die 20.000 Menschen, die zu einem friedlichen Spaziergang in der Wiener Innenstadt aufgebrochen waren und das trotz massiver Warnungen und Verbote aller angemeldeten Demonstrationen, auch jener der Parlamentspartei FPÖ. Abgesehen davon, dass diese Verbote mit solch hanebüchenen Begründungen in einer Demokratie wohl undenkbar wären und der
Verfassungsgerichtshof diesbezüglich sicher noch ein entsprechendes Urteil fällen wird, zeigen diese Sonntagsspaziergänge, dass der zivile Ungehorsam in der Bevölkerung wächst. Und es war sicher nur die Spitze eines Eisbergs, wenn 10.000 in Wien spazieren gehen, sind es wohl Millionen, die mit der Regierungspolitik mehr als unzufrieden sind. Und die Mär von Neonazis und Rechtsextremisten, die diese Spaziergänge dominiert hätten, richtet sich von selbst, wenn man die Bilder von Familien mit Kinderwagen und älteren Herrschaften sieht, die hier zum Teil durchaus mit Maske und immer um Abstand bemüht durch die Wiener Straßen zogen.
Wenn die Regierung, allen voran der dummdreist argumentierende Innenminister, all diese Menschen zu Neo-Nazis erklärt, begeht sie einen schweren Fehler. Diese Leute müssen erkennen, wie schnell es geht, dass man ein Neo-Nazi ist und sie müssen wohl auch denken, dass dieses Urteil nicht nur ungerecht, sondern schlichtweg unzutreffend und idiotisch ist. Tatsache ist jedenfalls, dass dies alles nicht ohne Auswirkung auf die politische Landschaft in Österreich bleiben wird: Die Regierung rasselt in den Umfragen hinunter, die Freiheitlichen stabilisieren sich und sie können sich mit der Unterstützung dieser neuen Bürgerbewegung ein politisches Alleinstellungsmerkmal erarbeiten. Und noch etwas ist klar: Die Regierung wird Neuwahlen zum gegebenen Zeitpunkt scheuen wie der Teufel das Weihwasser. Alle Gerüchte von einem Ende der Koalition, von der Bildung einer Konzentrationsregierung, dürften – da ein fliegender Wechsel ja mehr oder weniger ausgeschlossen ist – allein deshalb völlig gegenstandslos sein. Volkes Stimme wie sie sich beim Massenspaziergang äußerte, ist in der Demokratie nach wie vor der zentrale und wichtigste Faktor. Und noch ist Österreich eine solche Demokratie.


Eine neue Freiheits­bewegung

28. Januar 2021

Wenn die Bürger für ihre Grundrechte auf die Straße gehen …

Rechtsradikale seien sie, Aluhut-Träger, Verschwörungstheoretiker, Reichsbürger und Staatsfeinde! So heißt es über jene Menschen, die in diesen Tagen quer durch die Republik zwischen Neusiedlersee und Bodensee auf die Straße gehen, um gegen die Regierungsmaßnahmen zur Coronabekämpfung und die immer unerträglicher werdende Einschränkung der Freiheitsrechte zu demonstrieren. In Kleinstädten, ebenso wie in den Landeshauptstädten, und insbesondere in Wien vor Wochenfrist sind es indessen Zehntausende, die weitgehend unorganisiert und spontan ihren Unmut äußern. Und immer geht es ihnen ganz zentral um die Freiheit, um die Bürgerrechte, um die Bewegungsfreiheit, um die Erwerbsfreiheit und vor allem auch um die
Meinungsfreiheit.
Und gerade Letzteres ist ein Anliegen, das nur zu begründet erscheint, längst werden nämlich diese Menschen und überhaupt alle, die es wagen, eine kritische Meinung zu den Maßnahmen und zum Vorgehen der Regierung zu äußern, totgeschwiegen oder diffamiert. Die Bezeichnung „Corona-Leugner“ ist in dessen beinahe schon so stigmatisierend wie das Attribut „Holocaust-Leugner“ und tatsächlich gibt es quer durch Europa, auch in Österreich, Erwägungen, solche kritischen Stimmen zu kriminalisieren, im schlimmsten Falle zu internieren oder gar der Psychiatrie zuzuführen. Maßnahmen, wie sie schlimmer nicht in der Sowjetdiktatur des vorigen Jahrhunderts gegenüber Dissidenten vorgenommen wurden.
Dabei sind die Demonstrationen auf den Straßen der Republik nur so etwas wie die Spitze eines Eisbergs. Gerade bürgerliche Menschen oder die rechte Reichshälfte haben hierzulande keine Demonstrationskultur, es gehört nicht zu ihren politischen Usancen, auf die Straße zu gehen. Auch die Versuche rechter Parteien, wie etwa der Freiheitlichen, Großdemonstrationen zu organisieren, waren in den letzten Jahrzehnten stets nur von mäßigen Erfolg begleitet. Im Gegensatz zur Linken, die – unterstützt durch die Mainstream-Medien und auch weitgehend durch etablierte Parteien und Institutionen Zehntausende, wenn nicht gar Hunderttausende auf die Straße bringen konnten. Man denke an das Lichtermeer in den neunziger Jahren gegen das freiheitliche Volksbegehren „Österreich zuerst“.
Das bedeutet aber, dass beispielsweise die minimal 10.000 Teilnehmer bei der Großdemonstration am 16. Jänner des Jahres in Wien aller Wahrscheinlichkeit nach für hunderttausende Österreicher stehen, die ähnlich denken und die diese Demonstrationen zwar nicht selbst auf der Straße, aber in ihren Ansichten unterstützen. Mit Fug und Recht darf man annehmen, dass bei Anhalten der restriktiven Regierungspolitik, bei einer Verlängerung des mit dem Zustand des österreichischen Gesundheitssystems längst nicht mehr argumentierbaren Lockdowns dieser Bürgerprotest und der damit verbundene zivile Ungehorsam der Menschen verstärkt werden wird.
Auch wenn sich am Rande dieser Demonstrationen der eine oder andere politische Obskurant tummeln mag, möglicherweise der eine oder andere tatsächliche Rechtsextreme und derlei randständige Existenzen vielleicht da oder dort das große Wort zu führen versuchen, ist die soziologische Zusammensetzung dieses Bürgerprotests ganz zweifellos vielfältig und vielschichtig. Das sind enttäuschte ÖVP-Wähler und überzeugte Katholiken, wie frustrierte Ex-Grüne, da gibt es Sozialdemokraten, die so denken, wie der Wiener Gesundheitsstadtrat Hacker (man denke an sein Interview in der Sonntags-Krone vom 17. Jänner, wo er seinen Frust über die Regierungshysterie ausdrückte) und natürlich gibt es insgesamt viele freiheitsorientierte Menschen, wohl auch freiheitliche im Sinne der österreichischen Parteienlandschaft selbst. Und tatsächlich sind es im politischen Spektrum der Republik einzig und allein die Freiheitlichen, allen voran FPÖ-Klubobmann Herbert Kickl, die Verständnis und Unterstützung für diese neue bürgerliche Freiheitsbewegung signalisieren.
Die anderen Parteien, insbesondere die beiden Regierungsparteien ÖVP und Grüne, aber auch die Sozialdemokraten und NEOS und in geschlossener Front aller Mainstream-Medien, angeführt vom Staatsfunk ORF, verurteilen und diffamieren diese neue bürgerliche Freiheitsbewegung. Einzig die Freiheitlichen, die auf parlamentarischer Ebene die einzige oppositionelle Kraft gegen die Regierungsmaßnahmen darstellen, solidarisieren sich mit dieser Bewegung, ohne sie allerdings zu vereinnahmen. Zwar mag bei der großen Wiener Demonstration des 16. Jänner der eine oder andere Freiheitliche Politiker mit von der Partie gewesen sein, man vermied es aber klugerweise, sich in den Vordergrund zu drängen. Wohl im Bewusstsein, dass eine sich spontan entwickelnde Bürgerbewegung nicht aus rein taktischen Gründen vor den parteipolitischen Karren gespannt werden sollte, auch nicht vor den Freiheitlichen.
Dennoch ist eines klar: Das sind nicht Corona- Leugner, das sind nicht Verschwörungstheoretiker und das sind nicht Radikale, gleich welcher Richtung, es sind viel mehr Menschen aus der Mitte der Gesellschaft, besorgte Bürger, die um ihre Freiheitsrechte und um ihren Lebensstil fürchten. Und die bereit sind, gegen allgemeine mediale Schelte und gegen Diffamierung durch die etablierten Parteien offen auf die Straße zu gehen und sich zu diesen Protest zu bekennen. Und wenn freiheitsliebende Bürger diese Art in den oppositionellen Freiheitlichen die einzige politische Kraft erkennen müssen, die sich ebenso vorbehaltlos zur Bürgerfreiheit und zur Meinungsfreiheit bekennt, muss das nahezu zwangsläufig auch Folgen haben. Folgen, die man in den Umfragen bereits andeutungsweise erkennen kann und die sich in kommenden Wahlen auch mit Sicherheit niederschlagen werden. Darum aber geht es nicht primär, vielmehr geht es darum, tatsächlich für diese unsere Politik, für diese unseren freiheitlichen Rechtsstaat und für diesen unsere offene Gesellschaft einzutreten und sie zu schützen gegen Maßnahmen, die mit Sicherheit paternalistisch, ansatzweise auch schon autoritär sind. Und erstmals seit Jahrzehnten gibt es eine breite Bürgerbewegung, die dafür auf die Straße geht, die nicht von Links kommt. Ein Phänomen, das Sebastian Kurz und seiner Buberl-Partie im Kanzleramt zu denken geben sollte.


Auferstehung nach Ostern

21. Januar 2021

… aber in welchem Jahr?

Bereits am Beginn des ersten Lockdowns bei Ausbruch der Corona-Pandemie tröstete uns unser juveniler Bundeskanzler mit den Worten: Nach Ostern kommt die Auferstehung, dann werde alles vorbei sein, dann komme die Normalisierung. Und bereits damals merkten skeptische Stimmen an, dass der Herr Bundeskanzler nicht gesagt habe, in welchem Jahr. Und sie sollten Recht behalten. Denn zwölf Monate später, im Hier und Heute heißt es wieder, nach Ostern hätten wir es durchgestanden. Und auch dieses Mal hat der Regierungschef nicht dazu gesagt, nach Ostern in welchem Jahr.
So wie es aussieht, hat sich unsere hysterische Gesellschaft, und das leider nicht nur in Österreich, sondern europaweit, wenn nicht gar weltweit, auf den ewigen Lockdown geeinigt. Und um das den Menschen klar zu machen, hat man hierzulande in den letzten Tagen ganze Mannschaften von mehr oder minder hochqualifizierten Wissenschaftern, Ärzten, Virologen, Epidemiologen über die Medien losgelassen. Trotz sinkender Infektionszahlen, trotz geringer Auslastung der Krankenhausbetten und Intensivstationen, zwinge uns die tückische britische Mutation des Virus zum Radikal-Lockdown. Auf Wochen und Monate hinaus – und erst dann werde man sehen – und auch dann sei nichts gewiss. Nun wisse man gar nicht, wie weit diese britische Mutation nicht schon seit Monaten im Land virulent ist, ob sie es überhaupt ist, da die Sequenzierung noch nicht abgeschlossen ist und wir vor allem nicht wissen, ob diese trotz größerer Ansteckungsgefahr eine wirklich schwere Gesundheitsgefährdung mit sich bringt. Virologen, Mediziner, Epidemiologen legen uns ausschließlich ihren Standpunkt dar, ohne Rücksicht auf verfassungsrechtliche, nämlich bürgerrechtliche Bedenken, ohne Rücksicht auf die Wirtschaft, ohne Rücksicht auf die sozialen Auswirkungen dieses Lockdowns. Dabei werden Fakten und Argumente beliebig, willkürlich und manipulativ benützt. So meinte der Bundeskanzler beispielsweise, wir müssen es so wie Südtirol machen, das sich wieder in den Lockdown begibt. Glatt gelogen: In Südtirol haben die Schulen offen und die Geschäfte auch. Und die neueste Studie der Universität Stanford, wonach der Lockdown kaum Auswirkungen auf das Infektionsgeschehen hat, wird natürlich ignoriert, beziehungsweise totgeschwiegen.
Noch aber gibt es Stimmen der Vernunft. Etwa das große Interview des sozialistischen Wiener Gesundheitsstadtrats Hacker in der „Kronen Zeitung“, in der er seine Skepsis und seinen Frust gegenüber der grassierenden Hysterie in Politik und Wissenschaft darlegt. Oder der sonntägliche Kommentar des Herausgebers der zweitgrößten Boulevardzeitung des Landes, Wolfgang Fellner, der für ein rasches Ende des Lockdowns plädierte. Und natürlich die Wortmeldungen des FPÖ-Chefs Norbert Hofer und von FPÖ-Klubobmann Herbert Kickl. Und sie sind es auch, die dem zunehmenden Andrang zu Anti-Corona-Demonstrationen im Lande mit Verständnis begegnen. Zigtausende, die am vergangenen Samstag in Wien demonstrierten, werden von den Mainstream-Medien und der etablierten Politik ja pauschal als Extremisten, Wahnsinnige, Verschwörungstheoretiker abqualifiziert. Und als Beleg dafür wird eine Handvoll Namen aus dem ultrarechten Narrensaum der Republik zitiert. Dass hier in der Masse Zehntausende besorgte Bürger für Freizügigkeit und Bürgerfreiheit demonstrierten, wird ignoriert.
Tatsache ist allerdings, dass der zivile Ungehorsam im Lande wächst. Frustration und Ablehnung schlagen zunehmend in tätiges Unterlaufen der restriktiven Vorschriften um. Familientreffen ohne jede Rücksicht auf die vorgeschriebene Maximalzahl, Garagenparties, Demos ohne Maske, all das greift um sich, weil eine hysterische, widersprüchliche und unverständliche Politik die Menschen überfordert. Ob eine Rückkehr zur kritischen Vernunft und zur pragmatischen Kosten-Nutzen-Abwägung noch möglich ist? Wir können es nur hoffen.


Freiheit, Gesundheit, Geselligkeit

14. Januar 2021

Unsere Wünsche für das Jahr 2021

In seiner Neujahrsansprache stellte der Bundespräsident die Suggestivfrage: „Wollen wir nach der Coronakrise wirklich so weitermachen wie bisher?“ Und damit wollte er zweifellos die Wachstumsideologie der vergangenen Jahrzehnte, den vielgescholtenen Neoliberalismus, in Frage stellen. Gemäß grüner Polit-Phraseologie meinte er zweifellos, wir müssten uns nunmehr ganz zentral dem Klimaschutz, dem Artenschutz, dem Genderismus und der Politischen Korrektheit zuwenden.
Das hat natürlich einiges für sich, denn die Politik des immer mehr, schneller, höher, also des schrankenlosen Materialismus scheint tatsächlich an ihre Grenzen zu stoßen. Dennoch muss man unserem Staatsoberhaupt auf seine rhetorische Frage antworten: „Selbstverständlich wollen wir mit aller Kraft den Zustand vor Corona wieder herstellen. Einen Zustand nämlich, in dem es die Freiheit, die Gesundheit und die Geselligkeit für die Menschen gab.“
Dass gegenwärtig unsere Freiheit massiv beschränkt wird, ist wohl allenthalben klar. Ebenso, dass unsere Gesundheit durch dieses heimtückische Virus bedroht ist, wenn vielleicht diese Bedrohung auch durch eine globale Hysterie übertrieben wird. Und dass Geselligkeit in Zeiten des Lockdowns unterbunden wird, unsere Bedürfnisse als soziale Wesen unterdrückt werden, ist wohl auch keine Frage.
Es war unser juveniler Bundeskanzler, der bereits in der Anfangsphase der Corona-Pandemie davon sprach, dass es danach eine „neue Normalität“ geben werde. Und das darf man angesichts der Entwicklungen, die wir nunmehr ein Jahr erlebt haben, durchaus als ganz reale Bedrohung interpretiert werden. Wir taumeln nämlich in unserer Republik von einem Lockdown in den nächsten. Einmal Lockdown light, dann eben wieder hart. Aber seit nahezu einem Jahr mit kurzfristigen Unterbrechungen als Zustand, den die meisten Österreicher zunehmend als unerträglich empfinden: Unsere Bewegungsfreiheit wird massiv eingeschränkt, die Erwerbsfreiheit vieler Österreicher entfällt schlicht und einfach durch Geschäftsschließungen, durch Arbeitslosigkeit und Kurzarbeit. Unsere sozialen Kontakte, selbst innerhalb der Familien, etwa hin zur älteren Generation, werden zwangsweise unterbunden. Unsere Kinder haben seit nahezu einem Jahr keine geregelte Schule mehr und die ökonomischen Kosten für jede Woche Lockdown gehen in die Milliarden.
Die Regierung scheint nunmehr ihr ursprünglich deklariertes Prinzip „koste es, was es wolle“ bereits zu Gunsten des Mottos „hinter uns die Sintflut“ aufgegeben zu haben. Und die Frage der explodierenden Staatsschulden, nämlich „wann und wie wir sie zurückzahlen sollen“, wird gar nicht mehr gestellt.
Stattdessen vertröstet man die Bevölkerung von Woche zu Woche, kündigt jeweils ein Auslaufen des Lockdowns an, um diesen dann wieder völlig willkürlich zu verlängern, spricht seitens des Gesundheitsministers gerade schon stereotyp davon, dass jeweils die nächsten Tage die entscheidenden sein würden, schwingt seitens des Innenministers den Polizeistaats-Knüppel und verkündet als Kanzler die Frohbotschaft, dass es irgendwann im Sommer – in welchem Jahr? – wieder normale Verhältnisse geben werde.
Indessen aber malen die Apologeten der uns drohenden „neuen Normalität“ die Gefahren des mutierten Virus oder gar neuer, sogar noch gefährlicherer Viren an die Wand und lassen ziemlich unverblümt durchblicken, dass der Kampf gegen die angeblich drohende Klimakatastrophe wohl noch viel größere Einschränkungen erfordern würde als die Corona-Epidemie. Dass da immer mehr Menschen auch in den österreichischen Städten auf die Straße gehen, um dagegen zu protestieren, sollte zu denken geben.
Auch wenn sich dabei Obskuranten und Aluhutträger tummeln mögen, ist es doch ein Indiz, dass den Bürgern diese Zustände langsam unerträglich werden. Sie wünschen sich für das beginnende Jahr ihre Freiheit zurück, sie wollen ihre Gesundheit gewährleistet sehen. Und die Menschen wollen eine Rückkehr der für sie psychisch und physisch schlicht und einfach und lebensnotwendigen Geselligkeit. Geselligkeit in Form von unbeschränktem Familienleben, gemeinsamem Kulturgenuss, gemeinsamer Sportausübung, Stammtischen, Gastronomie, Kaffeehäusern, Reisen und Tourismus.
Das ist es, was die Menschen wollen und das ist genau die alte Normalität, mit der man durchaus auch gegen Wachstums-Fetischismus, für Umwelt und Klimaschutz eintreten kann. Und eine Regierung, die all das nicht erreichen bzw. gewährleisten kann, wird über kurz oder lang das Vertrauen der Bürger verlieren. Das steht außer Frage.


Janus – der doppel­gesichtige Gott des Paradigmen­wechsels

23. Dezember 2020

War das Corona-Jahr eine historische Wende?

Der Jahreswechsel hat für die Menschen etwas Mystisches an sich – trotz Knallerei, Sektkorken und Donauwalzer in Zeiten der alten Normalität, trotz der Friedhofsruhe in Zeiten des Lockdowns. Rückschau auf das vergangene Jahr und Ausblick auf das kommende. Janus, jener römische Gott des Anfangs und des Endes, jener Gott, der der ältesten und ursprünglichsten römischen Mythologie entspringt und im Gegensatz zu den anderen Göttern keine griechische Entsprechung hat, symbolisiert mit seiner Doppelgesichtigkeit diese Mystik des Jahreswechsels: Das Greisenantlitz, das in die Vergangenheit blickt und das Jünglingsgesicht, der Zukunft zugewandt.
Nun bedeutet „ianua“ auf Latein Tor, Tür oder Durchgang, und Janus symbolisiert damit die Dualität zwischen Leben und Tod, zwischen Schöpfung und Zerstörung, zwischen Zukunft und Vergangenheit, auch zwischen links und rechts, wenn man so will. Er ist somit auch der römische Gott der Türen und Tore, eben der Durchgänge und so ist dieser Janus somit gewissermaßen in seiner Doppelgesichtigkeit auch der Gott des Paradigmenwechsels.
Gerade nach dem annus horribile der Pandemie müssen wir uns nun legitimerweise wohl fragen, welche Art von Durchgang der heurige Jahreswechsel sein wird und ob das Coronajahr 2020 tatsächlich das Jahr eines welthistorischen Paradigmenwechsels war. Das Jahr eines grundlegenden Wandels in Hinblick auf unsere Werte, auf unsere Lebenseinstellung und auf die Rahmenbedingungen, unter denen wir dieses unser Leben gestalten.
Als Österreichs juveniler Regierungschef am Beginn der Pandemie die Floskel von der „neuen Normalität“ prägte, die uns nach der Bewältigung der Seuche drohen werde, hat er sich wahrscheinlich selbst nicht vorstellen können, in welchem Maße diese neue sich von der alten, von der herkömmlichen Normalität unterscheiden werde. Tatsächlich scheint jene Epoche, die nach dem Ende der bipolaren Weltordnung, nach dem Zusammenbruch des Ostblocks und des real existierenden Sozialismus sowjetkommunistischer Prägung im Jahre 1989 herrschte, nämlich die Epoche des Neoliberalismus, gepaart mit dem Glauben an den globalen Vormarsch der Demokratie westlicher Prägung, nunmehr ihr Ende zu finden.
Dieser Neoliberalismus mit seinem Glauben an Wettbewerb, Profit und Konsum und mit der damit verbundenen Technikgläubigkeit ist ja bereits vor den Tagen von Corona, insbesondere im Zuge der Debatte um die angesagte Klimakatastrophe, einer weltweiten Zukunftskepsis gewichen, einem Pessimismus mit subkutan apokalyptischer Orientierung. Der Glauben an die Kraft der Märkte und an ewiges Wirtschaftswachstum wurde dabei vom Streben nach Klimaschutz, nach Biodiversität und der Notwendigkeit, eben den Planeten als solchen zu retten, ausgehebelt. Nach der gewissermaßen automatischen Gestaltungskraft der Märkte ist nunmehr wieder die Regelungskompetenz des Staates gefragt. Und unsere freie Marktwirtschaft wird von einem System abgelöst, in dem Staatshilfen gepaart mit explodierenden Staatsschulden offenbar der einzige Rettungsanker zu sein scheinen.
Mit diesem Denken verbunden ist auch ein grundlegender Paradigmenwechsel im Hinblick auf die Rolle des Menschen in der Gesellschaft und im Staatsgefüge. Wenn es zuvor die sozusagen verantwortungslose Gier des Einzelnen war, welche dieses kapitalistisch-marktwirtschaftliches System angetrieben hat, so gilt es nun offenbar, die Menschen zu ihrem Glück und zu resilientem Verhalten zu bewegen – nötigenfalls auch zu zwingen. Dabei zeigt sich eine der großen, möglicherweise wirklich welthistorischen Veränderungen, die dieses Jahr mit sich gebracht hat: Wohlfahrt geht nämlich nunmehr zweifelsfrei in globalem Maßstab, insbesondere in den westlichen entwickelten Staaten vor Freiheit. Wohlfahrt im Sinne von Gesundheit und Wohlbefinden für möglichst alle, konkret im Sinne von Vermeidung von Infektionen durch das bösartige Coronavirus, geht vor Bürgerfreiheit, vor die Freiheits- und Grundrechte des Einzelnen.
Und daraus ergibt sich ein weiterer Paradigmenwechsel: Unsere demokratischen Systeme, die gereiften Demokratien in Europa und in den anderen westlichen Industriestaaten werden von einer Welle des politischen Paternalismus, der teilweise auch autoritäre Züge annimmt, überrollt. Die Einschränkungen von Grundrechten werden beinahe schon mit Polizeistaatsmethoden durchgesetzt, und der zuvor viel zitierte „mündige Bürger“ wird zum unmündigen Verordnungsbefolger degradiert.
Und dann gibt es da einen weiteren gewissermaßen soziologischen Paradigmenwechsel: Die „offene Gesellschaft“, wie sie nach den Vorstellungen Karl Poppers das Ziel hatte, die kritischen Fähigkeiten des Menschen freizusetzen und die Staatsgewalt möglichst soweit zu reduzieren, dass Machtmissbrauch nicht möglich wäre, diese offene Gesellschaft, die ja untrennbar mit der liberalen Demokratie und dem freiheitlichen Rechtsstaat verbunden ist, scheint schrittweise und schleichend ausgehöhlt zu werden.
Dies erweist sich nicht nur an den bereits erwähnten paternalistischen Vorgangsweisen der Regierenden und am Vormarsch eines – vorläufigen noch – sanften Polizeistaats, sondern auch in der im Zuge der Corona-Bekämpfung immer häufiger gewordenen Isolierung des Individuums beziehungsweise der Kleinfamilie. Der Rückzug ins Private, wie er in den Wochen des Lockdowns unumgänglich ist, da es „nur vier Gründe zum Verlassen der eigenen Wohnung“ gibt, bedingt diese Tendenz zur Isolierung. Und diesen Rückzug kennen wir ja auch am Beispiel historischer Phänomene, wie etwa des Biedermeiers, wo im Zuge des Metternichschen Polizeistaats der Bürger im Verschwiegenen und Privaten und im familiären Idyll sein Glück suchte.
Heute wird diese Isolierung durch die damit Hand in Hand gehende Digitalisierung entsprechend gefördert. Home-Working, Home-Office, Home-Schooling, Home-Wellness und natürlich Home-Entertainment, Entwicklungen bis hin zum Cyber-Sex sind es, die den Menschen als soziales Wesen aus seinen anthropologisch vorgegebenen Verhaltensweisen herausreißen. Jener Albtraum, den wir aus Science-Fiction Filmen kennen, wo pharmakologisch stillgelegte Individuen nur noch ein virtuelles Leben führen, lässt grüßen.
Diese zunehmende Isolierung des einzelnen Menschen, der seinen Alltag weitgehend vor den Bildschirmen seines Computers verbringt, ist aber in diesem Coronajahr zur flächendeckenden Realität geworden. Der Albtraum der Immobilienbranche, wonach große Konzerne kaum mehr Büroflächen brauchen werden, weil sie durch das Home-Office ersetzt werden, die Ängste von Kindern und Jugendlichen, die ihre Freunde nicht mehr treffen, weil ihr Alltag von Home-Schooling und E-Learning beherrscht wird und der drohende Bankrott der Kinounternehmen, deren Geschäft von Netflix, Sky und Prime Video übernommen wurde, ist längst Realität.
Und noch ein Kriterium unserer offenen Gesellschaft scheint in diesem Coronajahr ihr Ende gefunden zu haben: Die weltweite Mobilität im Bereich des Massentourismus. Ob im Zeitalter ständig wechselnder Grenzschließungen und restriktiver Quarantänebestimmungen für Reisende so etwas wie der Tourismus der vergangenen Jahrzehnte wiederaufleben kann, ist mehr als ungewiss. So ist die globale Kommunikation über Internet und Social Media in einem Maße intensiv und dicht geworden, dass die physische Mobilität offenbar nach und nach unnötig wird. Grenzüberschreitende Geschäftsreisen oder gar von einem Kontinent in den anderen für irgendwelche Konferenzen, sind längst unnötig geworden. Der Informationsaustausch übers Netz hat das persönliche Treffen, das persönliche Gespräch längst obsolet gemacht.
Von den weltweiten Reisebewegungen sind vorläufig nur jene der Armutsmigration aus den Entwicklungs- und Schwellenländern in Richtung der westlichen Industriestaaten übriggeblieben. Wie sich dieses zu erwartende Abnehmen der physischen Mobilität auf diese Migrationsbewegungen auswirken wird, ist auch alles andere als gewiss.
Möglicherweise also werden Historiker dereinst feststellen, dass in unseren Tagen eine wachstumsorientierte Wirtschaft, welche die Natur auf brutale Art und Weise vergewaltigte, gemeinsam wohl mit der globalen Bevölkerungsexplosion sowohl die Coronapandemie als auch die Klimakrise verursacht haben.
Und dass insbesondere die
Pandemie dann sozusagen die Schocktherapie für einen weltweiten Paradigmenwechsel darstellte. Einen radikalen Paradigmenwechsel, der dazu führte, dass Wohlfahrt vor Freiheit geht, dass die Reglementierung der Menschen vor demokratischer Partizipation geht, dass Meinungsfreiheit in vielen Bereichen einer Meinungsdisziplinierung weichen musste, um die Maßnahmen zur Bekämpfung der Klimakatastrophe und der Coronapandemie durchzusetzen und dass letztlich die klassische offene Gesellschaft sich in eine digitalisierte Gesellschaft individueller Isolierung wandelte.
Der doppelgesichtige römische Gott Janus, der Gott des Endes und des Anfangs, der Gott des Durchgangs und, wenn wir so wollen – in zeitgenössischem Soziologen-Chinesisch –, der Gott des Paradigmenwechsels, stand aber auch für die Erkenntnis, dass alles Göttliche immer einen Gegenspieler in sich birgt. Wenn also das hier skizzierte Zukunftsszenario eher bedrückende Aussichten bietet, sei letztendlich auf den berühmten Vers aus Hölderlins Patmos-Hymne verwiesen: „Wo aber Gefahr ist, wächst das Rettende auch“.


2020 – das verlorene Jahr

23. Dezember 2020

Ein Jahr geht zu Ende, das uns allen in denkbar schlechter Erinnerung bleiben wird. Gewiss, es war kein Kriegsjahr, es war auch kein Jahr großer Naturkatastrophen, aber es war ein Jahr einer weltweiten Pandemie namens­ COVID-19.
Nun war und ist diese Krankheit auch nicht die Beulenpest, auch nicht die Cholera und die Pocken. Das Virus, welches diese Krankheit hervorruft, ist aber heimtückisch und für alle jene, die – infiziert – einen schweren Krankheitsverlauf haben mit der Notwendigkeit, auf der Intensivstation künstlich beatmet zu werden, bis hin zum Tod, ist das Ganze alles andere als lustig. Nicht lustig aber ist auch, wie die Staaten und zwar nicht nur in Österreich, sondern insgesamt in Europa und weltweit darauf reagierten. Gerade jetzt zu Ende des Jahres befinden wir uns im dritten Lockdown, unser ganzes Gesellschaftsgefüge ist heruntergefahren, die Geschäfte geschlossen, ebenso die Wirtshäuser und Kaffeehäuser, die persönlichen Kontakte auf ein Minimum reduziert, die Schulen geschlossen.
Und damit sind wir beim wirklich Neuen dieser Pandemie. Niemals noch in der jüngeren Geschichte, auch nicht während der beiden Weltkriege, hat es so lang andauernde Ausgangsverbote gegeben, waren die Schulen so lange geschlossen, wurden die Wirtschaft und die individuelle Mobilität auf ein derartiges Minimum reduziert. Die ökonomischen Schäden des Ganzen sind überhaupt nicht abzusehen, die Firmenzusammenbrüche, die Konkurse kommen erst in ihrer wirklichen Dimension auf uns zu, ebenso die Arbeitslosigkeit. Und welche Folgen die explosive Erweiterung der Staatsschulden für uns alle haben wird, können wir nur erahnen. Massenarbeitslosigkeit, Vermögensverlust, galoppierende Inflation, breitflächige Verarmung, all das ist nicht nur möglich, sondern sogar wahrscheinlich. Und unsere Kinder, die Jugend des Landes, die Schüler, sie haben nahezu ein ganzes Jahr an Bildungsvermittlung, an Lernprozessen, an sozialen Kontakten verloren, sie mussten auf ihre Freunde verzichten, auf ihren Sport, weitgehend auf jeden Spaß und wurden in die Isolation des Internet­-Surfens getrieben.
Und die Alten, nicht nur jene, die isoliert und einsam auf der Intensivstation ohne letzten Kontakt mit den Lieben sterben mussten, auch jene, die möglicherweise durchaus gesund in den Alten- und Pflegeheimen leben, ihnen wurde eines jener wenigen Jahre, die ihnen noch bleiben, geraubt. Ohne zwischenmenschliche Kontakte, ohne Trost und ohne Beziehung zu ihren Verwandten und Lieben mussten sie dieses Jahr über sich ergehen lassen. Nun wäre es allzu leichtfertig, der Politik allein dafür die Schuld zuzuschieben. Mit Ausnahme der totalitären Staaten in Ostasien, wie China und Nordkorea, gibt es im globalen Maßstab kaum Beispiele für politisches Reagieren anderer Art auf die Epidemie. Und noch ist kein Ende abzusehen. Massentests und womöglich Zwangsimpfungen werden gegenwärtig als Lösungsansatz gepriesen. Ob wir uns damit wirklich aus dieser gesamtgesellschaftlichen Zwangslage, die mit der Epidemie verbunden ist, herausführen, ist auch ungewiss.
Was ist, wenn das Virus mutiert und die Impfung unwirksam wird, was ist, wenn ein neues Virus auftritt? Fragen über Fragen, die uns alle zum Jahreswechsel bange machen.
Und so bleibt nur die einigermaßen simple, wenn nicht gar törichte Erkenntnis: Das Leben ist lebensgefährlich und dennoch müssen wir es
leben.


Die verzagte Kirche

17. Dezember 2020

Vom Versagen der christlichen Kirchen in Zeiten von Corona

Der sogenannte „Lockdown“ liegt schwer und düster über dem Land, „Social Distancing“ lautet das Gebot der Stunde, vereinsamt isolieren sich die Menschen in ihren Wohnungen, die Alten und Uralten dämmern ihrem Ableben in den Alten- und Pflegeheime, ohne jeden Kontakt mit ihren Lieben entgegen, und auf den Straßen und an öffentlichen Orten müssen die Menschen ängstlich Distanz zueinander wahren. Ganz abgesehen von den ökonomischen Folgen, von Vermögensverlust und Einkommensrückgang, von Arbeitslosigkeit und Firmenzusammenbrüchen, sind es zunehmend psychische Belastungen, unter denen die Menschen in den Tagen der Pandemie leiden. Die bleibenden Schäden sind noch gar nicht abzuschätzen.
Wer spendet in diesen Tagen Trost, wo bleibt die Religion, wo bleiben die Kirchen, wo bleiben die Vertreter Gottes auf Erden, die Priester als Mittler zwischen Gott und den Menschen in diesen Tagen?
Sie sind in der Versenkung verschwunden. Die Kirchen sind geschlossen und dann, wenn sie wegen Lockerungen der Maßnahmen wieder aufmachen dürfen, verharren sie ängstlich in sklavischer Befolgung der Regeln von Social Distancing und formalisierter Hygiene, in furchtsamer Kälte und Ablehnung. Wo sind die Hirten, die ihre Herde und ihre Schäflein beschützen und ihnen Führung und Orientierung bieten, wo sind die flammenden Prediger, die ihre Gemeinde von der Kanzel ermuntern und ihnen Hoffnung spenden, wo sind die Glaubenszeugen, die ohne Rücksicht auf Leib und Leben für die Menschen eintreten? Es gibt sie nicht.
Und die Kirchenoberen quer durch Europa, seien es nun katholische Kirchefürsten, lutheranische Pastoren oder andere Repräsentanten christlicher Gemeinschaften, ihre öffentlichen Auftritte erschöpfen sich im Nachbeten der öffentlichen Maßnahmen, im Aufruf an ihre Gemeinden, doch ja den Restriktionen und Einschränkungen, die die Politik verordnet, brav und sklavisch zu folgen.
Rund 540 Millionen Europäer sind Christen, 75 % der Bevölkerung sind katholisch, evangelisch oder im Osten und im Südosten orthodox. Im Jahre 2005 hat allerdings das Europabarometer erhoben, dass nur 52 % der Europäer an Gott glauben und im Jahre 2014 haben kirchliche Umfragen gezeigt, dass nur mehr 11 % der Österreicher regelmäßig in Gottesdienste gehen. Die Entchristlichung des Abendlandes und des alten Kontinents schreitet also voran. Begonnen hat alles zweifellos mit der Aufklärung und der danach zunehmenden Wissenschaftsgläubigkeit. Gottesfurcht und Kirchengläubigkeit wurden vermeintlich durch wissenschaftlichen Fortschritt und neue Erkenntnisse in Frage gestellt. Dazu kam in den letzten Jahrzehnten die zunehmende Landflucht, die die in Sitten und Bräuchen verankerte Landbevölkerung entwurzelte und ihnen auch die Bindung zur Religion nahm. Der zunehmende Kulturverlust durch den spätlinken Zeitgeist, der gegenwärtig in unseren Breiten herrscht, tat ein Übriges. Hedonismus, Materialismus und Nihilismus traten ihren Siegeszug an und verdrängten gewissermaßen als Zivilreligion das Christentum. Das verstärkte Aufkommen von Missständen innerhalb der Kirchen, insbesondere innerhalb der Katholischen Kirche, wie etwa der sexuelle Missbrauch von Kindern, spitze die Situation noch mehr zu.
In wesentlichen Fragen der christlichen Moral verabsäumt man es, dass die Kirchen ihren Standpunkt gegenüber dem Zeitgeist artikulieren oder durchsetzen. Im Zuge der Massenmigration der letzten Jahre predigten die Kirchen zunehmend Fernstenliebe statt Nächstenliebe. Sie waren außerstande, die europäischen Bürger, die europäischen Völker, vor den mit dieser Massenmigration einhergehenden Gefährdungen zu verteidigen. In anderen moralischen Fragen, wie der Homosexualität, der Homoehe oder zuletzt auch der Sterbehilfe, der Heiligkeit des menschlichen Lebens, waren und sind die kirchlichen Stellungnahmen zögerlich, flau und alles andere als kämpferisch. Stattdessen zeigt sich beispielsweise die Katholische Kirche immer mehr wie eine zeitgeistige NGO. Nicht die Kirche als sakrale Institution, nein, die Kirche als Anhängsel der Caritas ist in der Öffentlichkeit vertreten.
Besonders deutlich wird das Versagen der Kirchen und des Christentums in Europa insgesamt durch theologische Defizite und damit einhergehende zaghafte Rückzugsgefechte. Wo predigen Kleriker noch über den Himmel und das Paradies als anzustrebendes Ziel des Christenlebens, wer hat noch den Mut, von Hölle und Verdammnis, vom Teufel zu sprechen? Letzteren haben die Kirchen gewissermaßen in zeitgeistiger Anpassung abgeschafft. Schriftglaube und Dogmenglaube ist solcherart gewissermaßen in stillem Einverständnis außer Kraft getreten und die christliche Rituale, wie sie sich in den Sakramenten und in der heiligen Messe manifestierten, werden zunehmend veräußerlicht und von den Menschen nicht mehr ernst genommen. Wer von den Millionen Taufscheinkatholiken in Europa geht etwa noch zur Beichte? Und die neue Priesterkaste wird nicht von den Kardinälen und Bischöfen repräsentiert, nein, es sind die Virologen und Epidemiologen, die am Bildschirm eine neue Priesterschaft repräsentieren.
Selbst der Vatikan, jene römische Enklave, in der nach katholischer Lesart der Stellvertreter Gottes amtiert, ist unter dem gegenwärtigen Pontifex Maximus eine Stätte geworden, in der statt Christentum eine gewisse Lesart eines „säkularen Humanismus“ gepflogen wird. Eine Stätte, in der mutmaßlich zunehmend Geheimgesellschaften im Hintergrund Einfluss gewinnen, jedenfalls aber der politisch korrekte Zeitgeist immer dominanter wird. Die Gebote eines trivialen Kulturmarxismus scheinen die Haltung des Heiligen Stuhls gegenüber den großen Problemen der Zeit zu bestimmen. Zwar ließ die deutsche Bischofskonferenz in diesen Tagen im Hinblick auf die Coronakrise verlautbaren, dass diese die „Fragilität und Verwundbarkeit der menschlichen Existenz“ aufzeige, und dass „grundlegende Fragen des menschlichen Zusammenlebens“ nunmehr relativiert würden. Eben dieselbe Bischofskonferenz und mit ihr alle Kirchenfürsten Europas lassen die spirituelle Führung der Menschen in Europa und weltweit vermissen, und in den Tagen der Weihnacht, in dem sich ein kulturell empfundenes Christentum gemeinsam mit Volksbräuchen und allgemeinen menschlichen Gemeinschaftsgefühlen paart, scheinen die Kirchen nicht willens und fähig zu sein, ihrem Auftrag der Seelsorge, der spirituellen Führung und des Trostes für die Menschen nachzukommen. Statt wirklicher Seelsorge und dem Spenden der Sakramente gibt es Online-Gottesdienste, und die Oberhirten glauben offenbar, das Christentum im Stile US-amerikanischer Fernsehprediger vertreten zu können. Die Quoten dieser Online-Seelsorge und die Akzeptanz durch die Gläubigen dürften allerdings vernichtend ausfallen.
Dazu kommt, dass diese zaghafte, diese ängstliche, diese defensive Katholische Kirche – gar nicht zu reden von ihren ökumenischen Brüdern aus den evangelischen Kirchen – gegenüber dem politischen Islam, der in Europa überaus offensiv auftritt, kein entsprechendes Gegengewicht aufzubringen im Stande sind. Zu den Parallelgesellschaften quer durch die österreichischen Bundesländer, die Großmoscheen errichten – angeblich ohne Gelder aus Katar und den Golfstaaten, wer’s glaubt –, gibt es nur zustimmendes Gemurmel unserer Kirchenoberen. Wenn der politische Islam in seinen extremistischen Ausformungen bereits in Missachtung unseres Rechtsstaates auf die Scharia setzt, wird von Seiten der christlichen Oberhirten über interreligiösen Diskurs gefaselt. Und wenn dieser politische Islamismus seine Assassinen ausschwärmen lässt, die quer durch Europa da und dort metzeln und morden, lädt unsere hohe Geistlichkeit Imame zum gemeinsamen Gebet in die mittelalterlichen Dome. Wehrhaftes Christentum sieht anders aus, wehrhaftes Christentum, auf das man unter dem polnischen Papst Wojtyla noch zu hoffen wagte, gibt es in Österreich und wohl in Europa insgesamt nicht mehr. Und damit schreitet die Entchristlichung des alten Kontinents weiter.


Und noch ein Corona-Flop

17. Dezember 2020

Strategien sind von Hilflosigkeit geprägt

Die Corona-Massentests, die uns der Herr Bundeskanzler relativ spontan und ohne Absprache mit irgendwelchen Experten verordnet hat, scheinen ein Flop zu werden. Von den nahezu 400.000 Vorarlbergern haben sich kaum 90.000 testen lassen, in Tirol waren es auch nur 30 Prozent, und in Wien werden es wohl auch nicht einmal 15 % sein. Und das bedeutet nicht mehr und nicht weniger, als dass der eigentliche Zweck dieser Massentests, nämlich ein Gesamtüberblick über das Infektionsgeschehen in Österreich zu erhalten, nicht erreicht werden kann.
Wenn wir nun das Corona-Jahr 2020 in Österreich Revue passieren lassen, so müssen wir einigermaßen beunruhigt feststellen, dass nahezu alle strategischen Maßnahmen der Bundesregierung versagt haben, ja veritable Flops geworden sind. Die ach so hochgelobte Corona-App des Roten Kreuzes, das Lieblingskind des Gesundheitsministers Anschober, sie wird nicht einmal von jenen Menschen genützt, die von den Corona-Ängsten gebeutelt werden. Oder die von der Regierung hoch gepriesene Corona-Ampel – gibt es sie eigentlich noch? – sollte doch die Maßnahmen quer durch die Republik regeln. Und dann das „Kaufhaus Österreich“, eine Lachnummer. Und nun also die Corona-Massentests. Samt und sonders Maßnahmen, die mit großem Aufwand an Steuergeld-Millionen organisiert und beworben wurden und die allesamt nichts gebracht haben.
Und da erweist sich, dass unser juveniler Bundeskanzler samt seiner Buberlpartie – zwei Mäderl sind auch dabei – im Grunde einigermaßen hilflos agiert. Diese Truppe, die nur zum Teil Berufserfahrung hat oder eine abgeschlossene Ausbildung, kaum je Verantwortung für eine eigene Familie getragen hat und ganz sicher nicht über Lebenserfahrung verfügt und schon gar nicht epidemiologische Expertise, hat uns all das eingebrockt. Nun kann man natürlich sagen: Es ist leicht zu kritisieren, wie aber wollte man es besser machen? Als Antwort kann man darauf sagen, die Regierung ist dafür gewählt, wird dafür bezahlt, die Probleme in solchen Situationen möglichst optimal zu lösen. Und das darf dann keine Frage der politischen Performance und der möglichst werbewirksamen Kommunikation sein, sondern von sach­orientierten Lösungsstrategien, und diese wird man nur mit Experten erarbeiten können und nicht mit einer politischen Selbstbestätigungs-Blase.
Als nächstes steht uns nunmehr die Massenimpfung ins Haus, und auch hier scheint die Regierung keine wirkliche Strategie zu haben, wie man die Österreicher vom Sinn dieser Impfung überzeugen könnte. Da wird es zweifellos zu wenig sein, Impfskeptiker als Narren und Verschwörungstheoretiker abzuqualifizieren, im Gegenteil – gegenwärtig scheint es so zu sein, als würde sich in der Bevölkerung so etwas wie passiver Widerstand breit machen.
Da treten bezahlte Promis im Staatsfunk auf und verkünden, sie würden sich testen beziehungsweise bald impfen lassen, und die Mehrheit der Österreicher denkt sich offenbar „Leck Buckl, wir aber nicht“. Und auch wenn der Gesundheitsminister in wöchentlichen Abständen verkündet, dass nunmehr genau die nächsten Tage Tage der finalen Entscheidung sein würden, der Bundeskanzler wie ein Sekten-Prediger die Milch der frommen Denkungsart hektoliterweise verschüttet und zusätzlich der Vizekanzler polternd droht und der Innenminister Kasernenhoftöne anschlägt: Die Österreicher scheint dies nicht mehr wirklich zu beeindrucken.
Und so taumelt die Regierung von einem Flop zum nächsten, und die Epidemie nimmt ihren Lauf.